ROBO2 anticorps

N° du produit ABIN635030

Détail du produit anti-ROBO2 anticorps

Antigène: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ROBO2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ROBO2 Blocking Peptide, catalog no. 33R-7307, is also available for use as a blocking control in assays to test for specificity of this ROBO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROBO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ROBO2

Antigène: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Autre désignation: ROBO2 (ROBO2 Produits)

Synonymes: anticorps SAX3, anticorps ROBO2, anticorps CG14347, anticorps CG14348, anticorps CG5481, anticorps CG5574, anticorps CT17326, anticorps D-Robo2, anticorps D-robo2, anticorps Dmel\\CG5481, anticorps Robo 2, anticorps Robo-2, anticorps Robo2, anticorps anon-EST:Liang-1.75, anticorps clone 1.75, anticorps dRobo-2, anticorps fus4, anticorps robo-2, anticorps robo2, anticorps unp1881, anticorps 2600013A04Rik, anticorps 9430089E08Rik, anticorps BB097918, anticorps D230004I22Rik, anticorps mKIAA1568, anticorps sax3, anticorps roundabout guidance receptor 2, anticorps roundabout 2, anticorps roundabout, axon guidance receptor, homolog 2 (Drosophila), anticorps roundabout guidance receptor 2 S homeolog, anticorps ROBO2, anticorps Robo2, anticorps robo2, anticorps robo2.S

Sujet: ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.

Poids moléculaire: 151 kDa (MW of target protein)

Pathways: Regulation of Cell Size