SLC25A6 anticorps
-
- Antigène Voir toutes SLC25A6 Anticorps
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
- Top Product
- Discover our top product SLC25A6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A6 Blocking Peptide, catalog no. 33R-5346, is also available for use as a blocking control in assays to test for specificity of this SLC25A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
- Autre désignation
- SLC25A6 (SLC25A6 Produits)
- Synonymes
- anticorps 2, anticorps 3, anticorps AAC3, anticorps ANT, anticorps ANT 2, anticorps ANT 3, anticorps ANT3, anticorps ANT3Y, anticorps SLC25A5, anticorps RGD1560896, anticorps wu:fj78b08, anticorps si:dkey-21o13.4, anticorps SLC25A6, anticorps solute carrier family 25 member 6, anticorps solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6, anticorps SLC25A6, anticorps Slc25a6, anticorps slc25a6
- Sujet
- SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
- Poids moléculaire
- 33 kDa (MW of target protein)
-