CYBA anticorps (Middle Region)

N° du produit ABIN635056

Détail du produit anti-CYBA anticorps

Antigène: CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYBA est non-conjugé

Application: Western Blotting (WB)

Specificité: CYBA antibody was raised against the middle region of CYBA

Purification: Affinity purified

Immunogène: CYBA antibody was raised using the middle region of CYBA corresponding to a region with amino acids TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYBA Blocking Peptide, catalog no. 33R-9120, is also available for use as a blocking control in assays to test for specificity of this CYBA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYBA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYBA

Antigène: CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))

Autre désignation: CYBA (CYBA Produits)

Synonymes: anticorps zgc:66077, anticorps MGC80750, anticorps CYBA, anticorps p22-phox, anticorps p22phox, anticorps p22-PHOX, anticorps b558, anticorps nmf333, anticorps P22-PHOX, anticorps cytochrome b-245, alpha polypeptide, anticorps cytochrome b-245 alpha polypeptide L homeolog, anticorps cytochrome b-245 alpha polypeptide, anticorps cytochrome b-245 light chain-like, anticorps cytochrome b-245 alpha chain, anticorps p22-phox, anticorps cyba, anticorps cyba.L, anticorps CYBA, anticorps LOC101328418, anticorps Cyba

Sujet: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones, Carbohydrate Homeostasis