DHODH anticorps (N-Term)

N° du produit ABIN635074

Détail du produit anti-DHODH anticorps

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB)

Specificité: DHODH antibody was raised against the N terminal of DHODH

Purification: Affinity purified

Immunogène: DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHODH Blocking Peptide, catalog no. 33R-7911, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: DHODH (DHODH Produits)

Synonymes: anticorps DHOdehase, anticorps POADS, anticorps URA1, anticorps 2810417D19Rik, anticorps AI834883, anticorps DDBDRAFT_0167009, anticorps DDBDRAFT_0185217, anticorps DDB_0167009, anticorps DDB_0185217, anticorps DHOD, anticorps DHODase, anticorps XFHB_12025, anticorps dhodh, anticorps dihydroorotate dehydrogenase (quinone), anticorps dihydroorotate dehydrogenase, anticorps dihydroorotate dehydrogenase (quinone) L homeolog, anticorps DHODH, anticorps Dhodh, anticorps pyrD, anticorps pyr4, anticorps Mrub_0263, anticorps Arnit_2124, anticorps Trad_2703, anticorps Ftrac_1484, anticorps Ndas_0799, anticorps Mesil_1876, anticorps Slip_0841, anticorps Spirs_1436, anticorps XFHB_RS12780, anticorps dhodh.L

Sujet: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus