DHODH anticorps (C-Term)
-
- Antigène Voir toutes DHODH Anticorps
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHODH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DHODH antibody was raised against the C terminal of DHODH
- Purification
- Affinity purified
- Immunogène
- DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
- Top Product
- Discover our top product DHODH Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHODH Blocking Peptide, catalog no. 33R-3293, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Autre désignation
- DHODH (DHODH Produits)
- Synonymes
- anticorps DHOdehase, anticorps POADS, anticorps URA1, anticorps 2810417D19Rik, anticorps AI834883, anticorps DDBDRAFT_0167009, anticorps DDBDRAFT_0185217, anticorps DDB_0167009, anticorps DDB_0185217, anticorps DHOD, anticorps DHODase, anticorps XFHB_12025, anticorps dhodh, anticorps dihydroorotate dehydrogenase (quinone), anticorps dihydroorotate dehydrogenase, anticorps dihydroorotate dehydrogenase (quinone) L homeolog, anticorps DHODH, anticorps Dhodh, anticorps pyrD, anticorps pyr4, anticorps Mrub_0263, anticorps Arnit_2124, anticorps Trad_2703, anticorps Ftrac_1484, anticorps Ndas_0799, anticorps Mesil_1876, anticorps Slip_0841, anticorps Spirs_1436, anticorps XFHB_RS12780, anticorps dhodh.L
- Sujet
- DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-