Slc25a1 anticorps
-
- Antigène Voir toutes Slc25a1 Anticorps
- Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Slc25a1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL
- Top Product
- Discover our top product Slc25a1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A1 Blocking Peptide, catalog no. 33R-6746, is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))
- Autre désignation
- SLC25A1 (Slc25a1 Produits)
- Synonymes
- anticorps MGC53598, anticorps slc25a1, anticorps zgc:63578, anticorps ctp, anticorps slc20a3, anticorps CG31305, anticorps CG6782, anticorps DmCIC, anticorps Dmel\\CG6782, anticorps SLC25A1, anticorps anon-WO0140519.12, anticorps l(3)EP3364, anticorps NV14384, anticorps 1300019P08Rik, anticorps 2610100G11Rik, anticorps AI194714, anticorps Ctp, anticorps Dgsj, anticorps Slc20a3, anticorps Cic, anticorps CTP, anticorps D2L2AD, anticorps SEA, anticorps SLC20A3, anticorps solute carrier family 25 member 1 L homeolog, anticorps solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1a, anticorps solute carrier family 25 member 1, anticorps scheggia, anticorps solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1, anticorps solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1, anticorps slc25a1.L, anticorps slc25a1a, anticorps slc25a1, anticorps SLC25A1, anticorps sea, anticorps Slc25a1
- Sujet
- The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.
- Poids moléculaire
- 34 kDa (MW of target protein)
-