SLC25A34 anticorps (Middle Region)
-
- Antigène Voir toutes SLC25A34 Anticorps
- SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A34 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC25 A34 antibody was raised against the middle region of SLC25 34
- Purification
- Affinity purified
- Immunogène
- SLC25 A34 antibody was raised using the middle region of SLC25 34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH
- Top Product
- Discover our top product SLC25A34 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A34 Blocking Peptide, catalog no. 33R-9006, is also available for use as a blocking control in assays to test for specificity of this SLC25A34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))
- Autre désignation
- SLC25A34 (SLC25A34 Produits)
- Synonymes
- anticorps slc25a34, anticorps zgc:77445, anticorps RP11-169K16.2, anticorps Gm1369, anticorps solute carrier family 25, member 34, anticorps solute carrier family 25 member 34, anticorps slc25a34, anticorps SLC25A34, anticorps Slc25a34
- Sujet
- SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.
- Poids moléculaire
- 32 kDa (MW of target protein)
-