CYP4A22 anticorps (N-Term)

N° du produit ABIN635097

Détail du produit anti-CYP4A22 anticorps

Antigène: CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP4A22 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CYP4 A22 antibody was raised against the N terminal of CYP4 22

Purification: Affinity purified

Immunogène: CYP4 A22 antibody was raised using the N terminal of CYP4 22 corresponding to a region with amino acids MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP4A22 Blocking Peptide, catalog no. 33R-6526, is also available for use as a blocking control in assays to test for specificity of this CYP4A22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP4A22

Antigène: CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))

Autre désignation: CYP4A22 (CYP4A22 Produits)

Synonymes: anticorps cytochrome P450 family 4 subfamily A member 22, anticorps cytochrome P450, family 4, subfamily A, polypeptide 22, anticorps CYP4A22

Sujet: CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Monocarboxylic Acid Catabolic Process