SLC15A2 anticorps
-
- Antigène Voir toutes SLC15A2 Anticorps
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC15A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC15 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
- Top Product
- Discover our top product SLC15A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC15A2 Blocking Peptide, catalog no. 33R-3445, is also available for use as a blocking control in assays to test for specificity of this SLC15A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
- Autre désignation
- SLC15A2 (SLC15A2 Produits)
- Synonymes
- anticorps PEPT2, anticorps pept2, anticorps MGC64416, anticorps wu:fc84g07, anticorps wu:fi22a10, anticorps zgc:152684, anticorps OPT-3, anticorps 8430408C16Rik, anticorps C78862, anticorps Pept2, anticorps solute carrier family 15 member 2, anticorps solute carrier family 15 member 2 L homeolog, anticorps solute carrier family 15 (oligopeptide transporter), member 2, anticorps solute carrier family 15 (H+/peptide transporter), member 2, anticorps SLC15A2, anticorps slc15a2.L, anticorps slc15a2, anticorps Slc15a2
- Sujet
- SLC15A2 belongs to the PTR2/POT transporter family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
- Poids moléculaire
- 82 kDa (MW of target protein)
-