OR10X1 anticorps (Middle Region)

N° du produit ABIN635112

Détail du produit anti-OR10X1 anticorps

Antigène: OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR10X1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR10 X1 antibody was raised against the middle region of OR10 1

Purification: Affinity purified

Immunogène: OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR10X1

Antigène: OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))

Autre désignation: OR10X1 (OR10X1 Produits)

Synonymes: anticorps OR1-13, anticorps OR1-14, anticorps OR10X1P, anticorps olfactory receptor family 10 subfamily X member 1 (gene/pseudogene), anticorps OR10X1

Sujet: OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Poids moléculaire: 36 kDa (MW of target protein)