OR10X1 anticorps (Middle Region)
-
- Antigène Voir toutes OR10X1 Anticorps
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OR10X1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OR10 X1 antibody was raised against the middle region of OR10 1
- Purification
- Affinity purified
- Immunogène
- OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
- Top Product
- Discover our top product OR10X1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
- Autre désignation
- OR10X1 (OR10X1 Produits)
- Synonymes
- anticorps OR1-13, anticorps OR1-14, anticorps OR10X1P, anticorps olfactory receptor family 10 subfamily X member 1 (gene/pseudogene), anticorps OR10X1
- Sujet
- OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Poids moléculaire
- 36 kDa (MW of target protein)
-