SV2A anticorps (Middle Region)

N° du produit ABIN635145

Détail du produit anti-SV2A anticorps

Antigène: SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SV2A est non-conjugé

Application: Western Blotting (WB)

Specificité: SV2 A antibody was raised against the middle region of SV2

Purification: Affinity purified

Immunogène: SV2 A antibody was raised using the middle region of SV2 corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SV2A Blocking Peptide, catalog no. 33R-4916, is also available for use as a blocking control in assays to test for specificity of this SV2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SV0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SV2A

Antigène: SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))

Autre désignation: SV2A (SV2A Produits)

Synonymes: anticorps AI746429, anticorps mKIAA0736, anticorps Sv2, anticorps SV2, anticorps synaptic vesicle glycoprotein 2A, anticorps synaptic vesicle glycoprotein 2 a, anticorps synaptic vesicle glycoprotein 2a, anticorps SV2A, anticorps CpipJ_CPIJ017596, anticorps sv2a, anticorps Sv2a

Sujet: SV2A plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. It positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.

Poids moléculaire: 83 kDa (MW of target protein)