LAX1 anticorps (Middle Region)
-
- Antigène Voir toutes LAX1 Anticorps
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LAX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LAX1 antibody was raised against the middle region of LAX1
- Purification
- Affinity purified
- Immunogène
- LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
- Top Product
- Discover our top product LAX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LAX1 Blocking Peptide, catalog no. 33R-4955, is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
- Autre désignation
- LAX1 (LAX1 Produits)
- Synonymes
- anticorps LAX, anticorps A530029E09, anticorps E430019B13Rik, anticorps lymphocyte transmembrane adaptor 1, anticorps LAX1, anticorps Lax1
- Sujet
- LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-