LAX1 anticorps (Middle Region)

N° du produit ABIN635163

Cet anticorps anti-LAX1 Polyclonal Lapin (ABIN635163) détecte spécifiquement LAX1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour LAX1 anticorps (Middle Region) (ABIN635163)

Antigène: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LAX1 anticorps

Épitope: Middle Region

Specificité: LAX1 antibody was raised against the middle region of LAX1

Purification: Affinity purified

Immunogène: LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAX1 Blocking Peptide, (ABIN940341), is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAX1

Antigène: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Autre désignation: LAX1

Sujet: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response