ZDHHC16 anticorps (C-Term)

N° du produit ABIN635217

Détail du produit anti-ZDHHC16 anticorps

Antigène: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC16 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC16 antibody was raised against the C terminal of ZDHHC16

Purification: Affinity purified

Immunogène: ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC16 Blocking Peptide, catalog no. 33R-9668, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC16

Antigène: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Autre désignation: ZDHHC16 (ZDHHC16 Produits)

Synonymes: anticorps APH2, anticorps MGC132171, anticorps 1500015N03Rik, anticorps Aph2, anticorps zdhhc16, anticorps zgc:66369, anticorps zgc:63934, anticorps zinc finger DHHC-type containing 16, anticorps zinc finger, DHHC-type containing 16 S homeolog, anticorps zinc finger, DHHC-type containing 16, anticorps zinc finger, DHHC domain containing 16, anticorps zinc finger, DHHC-type containing 16a, anticorps zinc finger, DHHC-type containing 16b, anticorps ZDHHC16, anticorps zdhhc16.S, anticorps Zdhhc16, anticorps zdhhc16, anticorps zdhhc16a, anticorps zdhhc16b

Sujet: ZDHHC16 may be involved in apoptosis regulation.

Poids moléculaire: 44 kDa (MW of target protein)