RNF217 anticorps (Middle Region)

N° du produit ABIN635258

Détail du produit anti-RNF217 anticorps

Antigène: RNF217 (Ring Finger Protein 217 (RNF217))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF217 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF217 antibody was raised against the middle region of RNF217

Purification: Affinity purified

Immunogène: RNF217 antibody was raised using the middle region of RNF217 corresponding to a region with amino acids GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF217 Blocking Peptide, catalog no. 33R-3383, is also available for use as a blocking control in assays to test for specificity of this RNF217 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF217 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF217

Antigène: RNF217 (Ring Finger Protein 217 (RNF217))

Autre désignation: RNF217 (RNF217 Produits)

Synonymes: anticorps Ibrdc1, anticorps RNF217, anticorps IBRDC1, anticorps C6orf172, anticorps dJ84N20.1, anticorps AU016819, anticorps ring finger protein 217, anticorps ring finger protein 217 L homeolog, anticorps Rnf217, anticorps RNF217, anticorps rnf217.L

Sujet: RNF217 is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Poids moléculaire: 32 kDa (MW of target protein)