IFNGR2 anticorps
-
- Antigène Voir toutes IFNGR2 Anticorps
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IFNGR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
- Top Product
- Discover our top product IFNGR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IFN Gamma R2 Blocking Peptide, catalog no. 33R-9941, is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
- Autre désignation
- IFN gamma R2 (IFNGR2 Produits)
- Synonymes
- anticorps Ifgr2, anticorps Ifgt, anticorps AF-1, anticorps IFGR2, anticorps IFNGT1, anticorps interferon gamma receptor 2, anticorps Ifngr2, anticorps IFNGR2, anticorps LOC487739
- Sujet
- IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.
- Poids moléculaire
- 35 kDa (MW of target protein)
-