ABCG5 anticorps

N° du produit ABIN635285

L’anticorps Lapin Polyclonal anti-ABCG5 a été validé pour WB. Il convient pour détecter ABCG5 dans des échantillons de Humain.

Aperçu rapide pour ABCG5 anticorps (ABIN635285)

Antigène: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCG5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCG5 anticorps

Purification: Affinity purified

Immunogène: ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCG5 Blocking Peptide, (ABIN937092), is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCG5

Antigène: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Autre désignation: ABCG5

Sujet: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Lipid Metabolism