ABCA5 anticorps

N° du produit ABIN635291

Détail du produit anti-ABCA5 anticorps

Antigène: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCA5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCA5 Blocking Peptide, catalog no. 33R-3759, is also available for use as a blocking control in assays to test for specificity of this ABCA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCA5

Antigène: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Autre désignation: ABCA5 (ABCA5 Produits)

Synonymes: anticorps zgc:163009, anticorps ABC13, anticorps EST90625, anticorps B930033A02Rik, anticorps mKIAA1888, anticorps ATP binding cassette subfamily A member 5, anticorps ATP-binding cassette, sub-family A (ABC1), member 5, anticorps ATP-binding cassette sub-family A member 5, anticorps ABCA5, anticorps abca5, anticorps LOC100545445, anticorps Abca5

Sujet: The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily.

Poids moléculaire: 186 kDa (MW of target protein)