SLCO2B1 anticorps (N-Term)

N° du produit ABIN635293

Détail du produit anti-SLCO2B1 anticorps

Antigène: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLCO2B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLCO2 B1 antibody was raised against the N terminal of SLCO2 1

Purification: Affinity purified

Immunogène: SLCO2 B1 antibody was raised using the N terminal of SLCO2 1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLCO2B1 Blocking Peptide, catalog no. 33R-2111, is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLCO2B1

Antigène: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Autre désignation: SLCO2B1 (SLCO2B1 Produits)

Synonymes: anticorps OATP2B1, anticorps DKFZp469P0119, anticorps im:7158298, anticorps wu:fi40d02, anticorps zgc:123236, anticorps OATP-B, anticorps OATPB, anticorps SLC21A9, anticorps AI060904, anticorps AI852653, anticorps Slc21a9, anticorps moat1, anticorps solute carrier organic anion transporter family member 2B1, anticorps solute carrier organic anion transporter family, member 2B1, anticorps solute carrier organic anion transporter family member 2B1 L homeolog, anticorps solute carrier organic anion transporter family, member 2b1, anticorps SLCO2B1, anticorps slco2b1, anticorps slco2b1.L, anticorps Slco2b1

Sujet: SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Poids moléculaire: 77 kDa (MW of target protein)