NRSN2 anticorps (Middle Region)

N° du produit ABIN635316

Détail du produit anti-NRSN2 anticorps

Antigène: NRSN2 (Neurensin 2 (NRSN2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRSN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Neurensin 2 antibody was raised against the middle region of NRSN2

Purification: Affinity purified

Immunogène: Neurensin 2 antibody was raised using the middle region of NRSN2 corresponding to a region with amino acids LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Neurensin 2 Blocking Peptide, catalog no. 33R-5159, is also available for use as a blocking control in assays to test for specificity of this Neurensin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRSN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRSN2

Antigène: NRSN2 (Neurensin 2 (NRSN2))

Autre désignation: Neurensin 2 (NRSN2 Produits)

Synonymes: anticorps C20orf98, anticorps dJ1103G7.6, anticorps Gm123, anticorps Neurensin-2, anticorps neurensin 2, anticorps NRSN2, anticorps Nrsn2

Sujet: NRSN2 may play a role in maintenance and/or transport of vesicles.

Poids moléculaire: 22 kDa (MW of target protein)