SLC7A1 anticorps
-
- Antigène Voir toutes SLC7A1 Anticorps
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC7 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA
- Top Product
- Discover our top product SLC7A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A1 Blocking Peptide, catalog no. 33R-2581, is also available for use as a blocking control in assays to test for specificity of this SLC7A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
- Autre désignation
- SLC7A1 (SLC7A1 Produits)
- Synonymes
- anticorps ATRC1, anticorps CAT-1, anticorps ERR, anticorps HCAT1, anticorps REC1L, anticorps CAT1, anticorps CATIONIC AMINO ACID TRANSPORTER 1, anticorps F7J7.60, anticorps F7J7_60, anticorps amino acid transporter 1, anticorps 4831426K01Rik, anticorps AI447493, anticorps Atrc-1, anticorps Atrc1, anticorps Cat1, anticorps Rec-1, anticorps Rev-1, anticorps mCAT-1, anticorps Cat-1, anticorps si:ch211-69k21.2, anticorps DKFZp459K194, anticorps solute carrier family 7 member 1, anticorps amino acid transporter 1, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 1, anticorps cationic amino acid transporter Cat1, anticorps SLC7A1, anticorps AAT1, anticorps Slc7a1, anticorps slc7a1, anticorps cat1
- Sujet
- SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-