SLC39A9 anticorps

N° du produit ABIN635326

Détail du produit anti-SLC39A9 anticorps

Antigène: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC39 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A9 Blocking Peptide, catalog no. 33R-10136, is also available for use as a blocking control in assays to test for specificity of this SLC39A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A9

Antigène: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Autre désignation: SLC39A9 (SLC39A9 Produits)

Synonymes: anticorps ZIP-9, anticorps ZIP9, anticorps 2010002A02Rik, anticorps 2610511I23Rik, anticorps 4833420E20Rik, anticorps AW209151, anticorps slc39a9, anticorps MGC83699, anticorps MGC89410, anticorps wu:fc56g12, anticorps zgc:101628, anticorps DKFZp469D105, anticorps solute carrier family 39 member 9, anticorps solute carrier family 39, member 9, anticorps solute carrier family 39 (zinc transporter), member 9, anticorps solute carrier family 39 member 9 S homeolog, anticorps solute carrier family 39 member 9 L homeolog, anticorps SLC39A9, anticorps Slc39a9, anticorps slc39a9.S, anticorps slc39a9.L, anticorps slc39a9

Sujet: SLC39A9 may act as a zinc-influx transporter.

Poids moléculaire: 32 kDa (MW of target protein)