SLC39A9 anticorps

N° du produit ABIN635326

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC39A9 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SLC39A9 anticorps (ABIN635326)

Antigène: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC39A9 anticorps

Purification: Affinity purified

Immunogène: SLC39 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A9 Blocking Peptide, (ABIN936101), is also available for use as a blocking control in assays to test for specificity of this SLC39A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A9

Antigène: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Autre désignation: SLC39A9

Sujet: SLC39A9 may act as a zinc-influx transporter.

Poids moléculaire: 32 kDa (MW of target protein)