SLC7A7 anticorps
-
- Antigène Voir toutes SLC7A7 (Slc7a7) Anticorps
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC7 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
- Top Product
- Discover our top product Slc7a7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A7 Blocking Peptide, catalog no. 33R-9952, is also available for use as a blocking control in assays to test for specificity of this SLC7A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
- Autre désignation
- SLC7A7 (Slc7a7 Produits)
- Synonymes
- anticorps LAT3, anticorps LPI, anticorps MOP-2, anticorps Y+LAT1, anticorps y+LAT-1, anticorps y+LAT1, anticorps AI790233, anticorps my+lat1, anticorps solute carrier family 7 member 7, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, anticorps SLC7A7, anticorps Slc7a7
- Sujet
- The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
- Poids moléculaire
- 56 kDa (MW of target protein)
-