SLC4A2 anticorps (N-Term)
-
- Antigène Voir toutes SLC4A2 Anticorps
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC4A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC4 A2 antibody was raised against the N terminal of SLC4 2
- Purification
- Affinity purified
- Immunogène
- SLC4 A2 antibody was raised using the N terminal of SLC4 2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
- Top Product
- Discover our top product SLC4A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC4A2 Blocking Peptide, catalog no. 33R-6496, is also available for use as a blocking control in assays to test for specificity of this SLC4A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
- Autre désignation
- SLC4A2 (SLC4A2 Produits)
- Synonymes
- anticorps AE2, anticorps BND3L, anticorps EPB3L1, anticorps HKB3, anticorps NBND3, anticorps SLC4A2, anticorps B3RP, anticorps Ae2, anticorps Aep2, anticorps AE 2, anticorps Anion exchanger 2, anticorps solute carrier family 4 member 2, anticorps anion exchange protein 2, anticorps solute carrier family 4 (anion exchanger), member 2, anticorps SLC4A2, anticorps LOC100599599, anticorps Slc4a2
- Sujet
- SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
- Poids moléculaire
- 137 kDa (MW of target protein)
-