OR2AT4 anticorps (N-Term)
-
- Antigène Voir toutes OR2AT4 Anticorps
- OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OR2AT4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OR2 AT4 antibody was raised against the N terminal of OR2 T4
- Purification
- Affinity purified
- Immunogène
- OR2 AT4 antibody was raised using the N terminal of OR2 T4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI
- Top Product
- Discover our top product OR2AT4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OR2AT4 Blocking Peptide, catalog no. 33R-5822, is also available for use as a blocking control in assays to test for specificity of this OR2AT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 T4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))
- Autre désignation
- OR2AT4 (OR2AT4 Produits)
- Synonymes
- anticorps OR11-265, anticorps olfactory receptor family 2 subfamily AT member 4, anticorps OR2AT4
- Sujet
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Poids moléculaire
- 35 kDa (MW of target protein)
-