SLC25A25 anticorps
-
- Antigène Voir toutes SLC25A25 Anticorps
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A25 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG
- Top Product
- Discover our top product SLC25A25 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A25 Blocking Peptide, catalog no. 33R-6204, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
- Autre désignation
- SLC25A25 (SLC25A25 Produits)
- Synonymes
- anticorps MCSC, anticorps PCSCL, anticorps RP11-395P17.4, anticorps SCAMC-2, anticorps 1110030N17Rik, anticorps mKIAA1896, anticorps Mcsc, anticorps Pcscl, anticorps mcsc, anticorps pcscl, anticorps scamc-2, anticorps scamc2, anticorps slc25a, anticorps slc25a25, anticorps wu:fb13d12, anticorps wu:fd14e03, anticorps zgc:77454, anticorps SLC25A25, anticorps solute carrier family 25 member 25, anticorps solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25, anticorps solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 L homeolog, anticorps solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25a, anticorps solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25, anticorps SLC25A25, anticorps Slc25a25, anticorps slc25a25.L, anticorps slc25a25a, anticorps slc25a25
- Sujet
- SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
- Poids moléculaire
- 55 kDa (MW of target protein)
-