SLC5A9 anticorps
-
- Antigène Voir toutes SLC5A9 Anticorps
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC5A9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC5 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
- Top Product
- Discover our top product SLC5A9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC5A9 Blocking Peptide, catalog no. 33R-6447, is also available for use as a blocking control in assays to test for specificity of this SLC5A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
- Autre désignation
- SLC5A9 (SLC5A9 Produits)
- Synonymes
- anticorps SLC5A9, anticorps SGLT4, anticorps AI159731, anticorps solute carrier family 5 member 9, anticorps solute carrier family 5 (sodium/sugar cotransporter), member 9, anticorps solute carrier family 5 (sodium/glucose cotransporter), member 9, anticorps Slc5a9, anticorps SLC5A9, anticorps slc5a9
- Sujet
- SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
- Poids moléculaire
- 76 kDa (MW of target protein)
-