SLC27A6 anticorps

N° du produit ABIN635364

Détail du produit anti-SLC27A6 anticorps

Antigène: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC27A6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC27A6 Blocking Peptide, catalog no. 33R-4665, is also available for use as a blocking control in assays to test for specificity of this SLC27A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC27A6

Antigène: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Autre désignation: SLC27A6 (SLC27A6 Produits)

Synonymes: anticorps zgc:153783, anticorps ACSVL2, anticorps FACVL2, anticorps FATP6, anticorps VLCS-H1, anticorps 4732438L20Rik, anticorps solute carrier family 27 member 6, anticorps solute carrier family 27 (fatty acid transporter), member 6, anticorps solute carrier family 27 member 6 L homeolog, anticorps SLC27A6, anticorps slc27a6, anticorps slc27a6.L, anticorps Slc27a6

Sujet: SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 70 kDa (MW of target protein)