ART3 anticorps (Middle Region)

N° du produit ABIN635414

Détail du produit anti-ART3 anticorps

Antigène: ART3 (ADP-Ribosyltransferase 3 (ART3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ART3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ART3 antibody was raised against the middle region of ART3

Purification: Affinity purified

Immunogène: ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ART3

Antigène: ART3 (ADP-Ribosyltransferase 3 (ART3))

Autre désignation: ART3 (ART3 Produits)

Synonymes: anticorps ARTC3, anticorps 4930569O04Rik, anticorps ART3, anticorps DKFZp468P1925, anticorps ADP-ribosyltransferase 3, anticorps ART3, anticorps Art3

Sujet: ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.

Poids moléculaire: 40 kDa (MW of target protein)