KLRC3 anticorps (N-Term)
-
- Antigène Voir toutes KLRC3 Anticorps
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLRC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLRC3 antibody was raised against the N terminal of KLRC3
- Purification
- Affinity purified
- Immunogène
- KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
- Top Product
- Discover our top product KLRC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLRC3 Blocking Peptide, catalog no. 33R-6452, is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
- Autre désignation
- KLRC3 (KLRC3 Produits)
- Synonymes
- anticorps Klrc2, anticorps Nkg2e, anticorps KLRC2, anticorps NKG2-C, anticorps NKG2-E, anticorps NKG2E, anticorps killer cell lectin-like receptor subfamily C, member 3, anticorps killer cell lectin like receptor C3, anticorps Klrc3, anticorps KLRC3
- Sujet
- Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.
- Poids moléculaire
- 27 kDa (MW of target protein)
-