ELFN2 anticorps (N-Term)
-
- Antigène Voir toutes ELFN2 Anticorps
- ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELFN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ELFN2 antibody was raised against the N terminal of ELFN2
- Purification
- Affinity purified
- Immunogène
- ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH
- Top Product
- Discover our top product ELFN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ELFN2 Blocking Peptide, catalog no. 33R-7422, is also available for use as a blocking control in assays to test for specificity of this ELFN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELFN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))
- Autre désignation
- ELFN2 (ELFN2 Produits)
- Synonymes
- anticorps LRRC62, anticorps PPP1R29, anticorps dJ63G5.3, anticorps 6330514E13, anticorps AW048948, anticorps BC094219, anticorps Lrrc62, anticorps Ppp1r29, anticorps Elfn2-ps1, anticorps RGD1559693, anticorps extracellular leucine rich repeat and fibronectin type III domain containing 2, anticorps leucine rich repeat and fibronectin type III, extracellular 2, anticorps extracellular leucine-rich repeat and fibronectin type III domain containing 2, anticorps ELFN2, anticorps Elfn2
- Sujet
- ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.
- Poids moléculaire
- 90 kDa (MW of target protein)
-