NAT8B anticorps
-
- Antigène Voir toutes NAT8B Anticorps
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NAT8B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NAT8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
- Top Product
- Discover our top product NAT8B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NAT8B Blocking Peptide, catalog no. 33R-8328, is also available for use as a blocking control in assays to test for specificity of this NAT8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
- Autre désignation
- NAT8B (NAT8B Produits)
- Synonymes
- anticorps EG434057, anticorps Cml1, anticorps Cml6, anticorps Nat8, anticorps RGD621605, anticorps CML2, anticorps Hcml2, anticorps NAT8BP, anticorps N-acetyltransferase 8B, anticorps N-acetyltransferase 8B, pseudogene, anticorps N-acetyltransferase 8B (putative, gene/pseudogene), anticorps NAT8B, anticorps Nat8b-ps, anticorps Nat8b
- Sujet
- The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.
- Poids moléculaire
- 25 kDa (MW of target protein)
-