Seladin 1 anticorps (Middle Region)

N° du produit ABIN635527

Détail du produit anti-Seladin 1 anticorps

Antigène: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Seladin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DHCR24 antibody was raised against the middle region of DHCR24

Purification: Affinity purified

Immunogène: DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHCR24 Blocking Peptide, catalog no. 33R-1138, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Seladin 1

Antigène: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Autre désignation: DHCR24 (DHCR24 Produits)

Synonymes: anticorps MGC82737, anticorps zgc:101638, anticorps DCE, anticorps Nbla03646, anticorps SELADIN1, anticorps seladin-1, anticorps 2310076D10Rik, anticorps 5830417J06Rik, anticorps mKIAA0018, anticorps 24-dehydrocholesterol reductase, anticorps 24-dehydrocholesterol reductase S homeolog, anticorps delta(24)-sterol reductase, anticorps DHCR24, anticorps dhcr24.S, anticorps dhcr24, anticorps LOC5575872, anticorps CpipJ_CPIJ000670, anticorps Dhcr24

Sujet: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis.

Poids moléculaire: 58 kDa (MW of target protein)