MAN1A2 anticorps (Middle Region)
-
- Antigène Voir toutes MAN1A2 Anticorps
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAN1A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAN1 A2 antibody was raised against the middle region of MAN1 2
- Purification
- Affinity purified
- Immunogène
- MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
- Top Product
- Discover our top product MAN1A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
- Autre désignation
- MAN1A2 (MAN1A2 Produits)
- Synonymes
- anticorps man1b, anticorps MAN1B, anticorps AI428775, anticorps AI528764, anticorps AI854422, anticorps Man1b, anticorps PCR2, anticorps mannosidase, alpha, class 1A, member 2 L homeolog, anticorps mannosidase alpha class 1A member 2, anticorps mannosidase, alpha, class 1A, member 2, anticorps man1a2.L, anticorps MAN1A2, anticorps Man1a2
- Sujet
- Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.
- Poids moléculaire
- 73 kDa (MW of target protein)
-