SUN2 anticorps

N° du produit ABIN635564

L’anticorps anti-SUN2 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de SUN2 dans des échantillons provenant de Humain, Rat et Souris. }

Aperçu rapide pour SUN2 anticorps (ABIN635564)

Antigène: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SUN2 anticorps

Purification: Affinity purified

Immunogène: UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC84B Blocking Peptide, (ABIN937217), is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUN2

Antigène: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Autre désignation: UNC84B

Sujet: UNC84B plays a role in mitotic spindle organization and biogenesis.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2