MAS1 anticorps (Middle Region)
-
- Antigène Voir toutes MAS1 Anticorps
- MAS1 (MAS1 Oncogene (MAS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAS1 antibody was raised against the middle region of MAS1
- Purification
- Affinity purified
- Immunogène
- MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII
- Top Product
- Discover our top product MAS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAS1 Blocking Peptide, catalog no. 33R-9598, is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAS1 (MAS1 Oncogene (MAS1))
- Autre désignation
- MAS1 (MAS1 Produits)
- Synonymes
- anticorps MAS, anticorps Mas-1, anticorps c-mas, anticorps MAS1, anticorps MAS1 proto-oncogene, G protein-coupled receptor, anticorps MAS1 oncogene, anticorps proto-oncogene Mas, anticorps MAS1, anticorps Mas1, anticorps LOC703105
- Sujet
- The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process
-