TMEM74 anticorps (Middle Region)

N° du produit ABIN635595

Détail du produit anti-TMEM74 anticorps

Antigène: TMEM74 (Transmembrane Protein 74 (TMEM74))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM74 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM74 antibody was raised against the middle region of TMEM74

Purification: Affinity purified

Immunogène: TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM74 Blocking Peptide, catalog no. 33R-2701, is also available for use as a blocking control in assays to test for specificity of this TMEM74 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM74 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM74

Antigène: TMEM74 (Transmembrane Protein 74 (TMEM74))

Autre désignation: TMEM74 (TMEM74 Produits)

Synonymes: anticorps NET36, anticorps AA549547, anticorps B230382K22Rik, anticorps RGD1566279, anticorps transmembrane protein 74, anticorps Transmembrane protein 74, anticorps TMEM74, anticorps tmm74, anticorps Tmem74

Sujet: TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.

Poids moléculaire: 33 kDa (MW of target protein)