SLC22A8 anticorps
-
- Antigène Voir toutes SLC22A8 Anticorps
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC22 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
- Top Product
- Discover our top product SLC22A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A8 Blocking Peptide, catalog no. 33R-7064, is also available for use as a blocking control in assays to test for specificity of this SLC22A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
- Autre désignation
- SLC22A8 (SLC22A8 Produits)
- Synonymes
- anticorps OAT3, anticorps Oat3, anticorps Roct, anticorps OCT3, anticorps solute carrier family 22 member 8, anticorps solute carrier family 22 (organic anion transporter), member 8, anticorps SLC22A8, anticorps Slc22a8
- Sujet
- SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Poids moléculaire
- 60 kDa (MW of target protein)
-