TMEM146 anticorps (Middle Region)
-
- Antigène Voir toutes TMEM146 Anticorps
- TMEM146 (Transmembrane Protein 146 (TMEM146))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM146 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM146 antibody was raised against the middle region of TMEM146
- Purification
- Affinity purified
- Immunogène
- TMEM146 antibody was raised using the middle region of TMEM146 corresponding to a region with amino acids NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
- Top Product
- Discover our top product TMEM146 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM146 Blocking Peptide, catalog no. 33R-6818, is also available for use as a blocking control in assays to test for specificity of this TMEM146 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM146 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM146 (Transmembrane Protein 146 (TMEM146))
- Autre désignation
- TMEM146 (TMEM146 Produits)
- Synonymes
- anticorps TMEM146, anticorps 4921529N20Rik, anticorps 4933402B14Rik, anticorps 619718, anticorps AW045609, anticorps Gm6095, anticorps Tmem146, anticorps cation channel sperm associated auxiliary subunit delta, anticorps CATSPERD, anticorps Catsperd
- Sujet
- TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.
- Poids moléculaire
- 90 kDa (MW of target protein)
-