ZDHHC18 anticorps (Middle Region)
-
- Antigène Voir toutes ZDHHC18 Anticorps
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZDHHC18 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZDHHC18 antibody was raised against the middle region of ZDHHC18
- Purification
- Affinity purified
- Immunogène
- ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII
- Top Product
- Discover our top product ZDHHC18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
- Autre désignation
- ZDHHC18 (ZDHHC18 Produits)
- Synonymes
- anticorps fi45c03, anticorps wu:fi45c03, anticorps wu:fj48h10, anticorps zgc:55843, anticorps zdhhc18, anticorps zgc:153461, anticorps DHHC-18, anticorps DHHC18, anticorps zinc finger, DHHC-type containing 18b, anticorps zinc finger, DHHC-type containing 18a, anticorps zinc finger DHHC-type containing 18, anticorps zinc finger, DHHC domain containing 18, anticorps zinc finger, DHHC-type containing 18, anticorps zdhhc18b, anticorps zdhhc18a, anticorps ZDHHC18, anticorps Zdhhc18
- Sujet
- ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.
- Poids moléculaire
- 42 kDa (MW of target protein)
-