ZDHHC18 anticorps (Middle Region)

N° du produit ABIN635634

Détail du produit anti-ZDHHC18 anticorps

Antigène: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC18 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC18 antibody was raised against the middle region of ZDHHC18

Purification: Affinity purified

Immunogène: ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC18

Antigène: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Autre désignation: ZDHHC18 (ZDHHC18 Produits)

Synonymes: anticorps fi45c03, anticorps wu:fi45c03, anticorps wu:fj48h10, anticorps zgc:55843, anticorps zdhhc18, anticorps zgc:153461, anticorps DHHC-18, anticorps DHHC18, anticorps zinc finger, DHHC-type containing 18b, anticorps zinc finger, DHHC-type containing 18a, anticorps zinc finger DHHC-type containing 18, anticorps zinc finger, DHHC domain containing 18, anticorps zinc finger, DHHC-type containing 18, anticorps zdhhc18b, anticorps zdhhc18a, anticorps ZDHHC18, anticorps Zdhhc18

Sujet: ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

Poids moléculaire: 42 kDa (MW of target protein)