IGHV5-2 anticorps (N-Term)
IGHV5-2
Reactivité: Humain
WB
Hôte: Lapin
Polyclonal
unconjugated
1 image
-
- Antigène
- IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))
- Épitope
- N-Term
- Reactivité
- Humain
- Hôte
- Lapin
- Clonalité
- Polyclonal
- Application
- Western Blotting (WB)
- Specificité
- PIGZ antibody was raised against the N terminal of PIGZ
- Purification
- Affinity purified
- Immunogène
- PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIGZ Blocking Peptide, catalog no. 33R-9694, is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))
- Autre désignation
- IGZ
- Sujet
- The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
- Poids moléculaire
- 63 kDa (MW of target protein)
-
Vous êtes ici:
