RPN1 anticorps (Middle Region)

N° du produit ABIN635681

Détail du produit anti-RPN1 anticorps

Antigène: RPN1 (Ribophorin 1 (RPN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Ribophorin I antibody was raised against the middle region of RPN1

Purification: Affinity purified

Immunogène: Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ribophorin I Blocking Peptide, catalog no. 33R-1015, is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPN1

Antigène: RPN1 (Ribophorin 1 (RPN1))

Autre désignation: Ribophorin I (RPN1 Produits)

Synonymes: anticorps OST1, anticorps RBPH1, anticorps AU018702, anticorps D6Wsu137e, anticorps Rpn-1, anticorps RIBI, anticorps wu:fa12h07, anticorps wu:fc68b07, anticorps wu:fc88a12, anticorps ost1, anticorps xrpn1, anticorps ribophorin I, anticorps ribophorin I L homeolog, anticorps PVX_119685, anticorps NAEGRDRAFT_78171, anticorps RPN1, anticorps Rpn1, anticorps rpn1, anticorps rpn1.L

Sujet: This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

Poids moléculaire: 66 kDa (MW of target protein)