LRCH4 anticorps
-
- Antigène Voir toutes LRCH4 Anticorps
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRCH4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVP
- Top Product
- Discover our top product LRCH4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRCH4 Blocking Peptide, catalog no. 33R-2059, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
- Autre désignation
- LRCH4 (LRCH4 Produits)
- Synonymes
- anticorps LRN, anticorps LRRN1, anticorps LRRN4, anticorps PP14183, anticorps 2810008P14Rik, anticorps 2900069C24Rik, anticorps AI558103, anticorps SAP25, anticorps mFLJ00248, anticorps si:dkeyp-73c8.2, anticorps leucine rich repeats and calponin homology domain containing 4, anticorps leucine-rich repeats and calponin homology (CH) domain containing 4, anticorps LRCH4, anticorps Lrch4, anticorps lrch4
- Sujet
- This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.
- Poids moléculaire
- 73 kDa (MW of target protein)
-