PTPRR anticorps (C-Term)

N° du produit ABIN635722

Détail du produit anti-PTPRR anticorps

Antigène: PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPRR est non-conjugé

Application: Western Blotting (WB)

Specificité: PTPRR antibody was raised against the C terminal of PTPRR

Purification: Affinity purified

Immunogène: PTPRR antibody was raised using the C terminal of PTPRR corresponding to a region with amino acids NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTPRR Blocking Peptide, catalog no. 33R-6944, is also available for use as a blocking control in assays to test for specificity of this PTPRR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTPRR

Antigène: PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))

Autre désignation: PTPRR (PTPRR Produits)

Synonymes: anticorps EC-PTP, anticorps PCPTP1, anticorps PTP-SL, anticorps PTPBR7, anticorps PTPRQ, anticorps Pcptp1, anticorps ec-ptp, anticorps pcptp1, anticorps ptp-sl, anticorps ptpbr7, anticorps PTPRR, anticorps Gmcp1, anticorps RPTPRR, anticorps mPTP213, anticorps protein tyrosine phosphatase, receptor type R, anticorps protein tyrosine phosphatase, receptor type, R, anticorps protein tyrosine phosphatase, receptor type R L homeolog, anticorps protein tyrosine phosphatase, receptor type, r, anticorps receptor-type tyrosine-protein phosphatase R, anticorps PTPRR, anticorps Ptprr, anticorps ptprr.L, anticorps ptprr, anticorps LOC100715069

Sujet: PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.

Poids moléculaire: 46 kDa (MW of target protein)