NKAIN1 anticorps (Middle Region)
-
- Antigène Voir toutes NKAIN1 Anticorps
- NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NKAIN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NKAIN1 antibody was raised against the middle region of NKAIN1
- Purification
- Affinity purified
- Immunogène
- NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV
- Top Product
- Discover our top product NKAIN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NKAIN1 Blocking Peptide, catalog no. 33R-9236, is also available for use as a blocking control in assays to test for specificity of this NKAIN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))
- Autre désignation
- NKAIN1 (NKAIN1 Produits)
- Synonymes
- anticorps FAM77C, anticorps 2610200G18Rik, anticorps 2810426C15Rik, anticorps RGD1561205, anticorps fam77c, anticorps sodium/potassium transporting ATPase interacting 1, anticorps Na+/K+ transporting ATPase interacting 1, anticorps Sodium/potassium transporting ATPase interacting 1, anticorps Na+/K+ transporting ATPase interacting 1 L homeolog, anticorps NKAIN1, anticorps Nkain1, anticorps nkain1.L
- Sujet
- It belongs to the NKAIN family. The exact function of NKAIN1 remains unknown.
- Poids moléculaire
- 18 kDa (MW of target protein)
-