NKAIN1 anticorps (Middle Region)

N° du produit ABIN635733

Détail du produit anti-NKAIN1 anticorps

Antigène: NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKAIN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NKAIN1 antibody was raised against the middle region of NKAIN1

Purification: Affinity purified

Immunogène: NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKAIN1 Blocking Peptide, catalog no. 33R-9236, is also available for use as a blocking control in assays to test for specificity of this NKAIN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKAIN1

Antigène: NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))

Autre désignation: NKAIN1 (NKAIN1 Produits)

Synonymes: anticorps FAM77C, anticorps 2610200G18Rik, anticorps 2810426C15Rik, anticorps RGD1561205, anticorps fam77c, anticorps sodium/potassium transporting ATPase interacting 1, anticorps Na+/K+ transporting ATPase interacting 1, anticorps Sodium/potassium transporting ATPase interacting 1, anticorps Na+/K+ transporting ATPase interacting 1 L homeolog, anticorps NKAIN1, anticorps Nkain1, anticorps nkain1.L

Sujet: It belongs to the NKAIN family. The exact function of NKAIN1 remains unknown.

Poids moléculaire: 18 kDa (MW of target protein)