Tetraspanin 3 anticorps (Middle Region)

N° du produit ABIN635759

L’anticorps anti-Tetraspanin 3 Polyclonal Lapin est utilisé pour la détection de Tetraspanin 3 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Tetraspanin 3 anticorps (Middle Region) (ABIN635759)

Antigène: Tetraspanin 3 (TSPAN3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tetraspanin 3 anticorps

Épitope: Middle Region

Specificité: Tetraspanin 3 antibody was raised against the middle region of TSPAN3

Purification: Affinity purified

Immunogène: Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 3 Blocking Peptide, (ABIN5616557), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 3

Antigène: Tetraspanin 3 (TSPAN3)

Autre désignation: Tetraspanin 3

Sujet: TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 25 kDa (MW of target protein)