Tetraspanin 3 anticorps (Middle Region)
-
- Antigène Voir toutes Tetraspanin 3 (TSPAN3) Anticorps
- Tetraspanin 3 (TSPAN3)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Tetraspanin 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Tetraspanin 3 antibody was raised against the middle region of TSPAN3
- Purification
- Affinity purified
- Immunogène
- Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG
- Top Product
- Discover our top product TSPAN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tetraspanin 3 Blocking Peptide, catalog no. 33R-8740, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Tetraspanin 3 (TSPAN3)
- Autre désignation
- Tetraspanin 3 (TSPAN3 Produits)
- Synonymes
- anticorps tm4-a, anticorps tm4sf8, anticorps tspan-3, anticorps fj34d08, anticorps si:dkey-24l11.4, anticorps wu:fj34d08, anticorps zgc:114050, anticorps DKFZp469M0635, anticorps TM4-A, anticorps TM4SF8, anticorps TSPAN-3, anticorps 1700055K04Rik, anticorps Tm4sf8, anticorps tetraspanin 3, anticorps tetraspanin 3a, anticorps tetraspanin 3 S homeolog, anticorps TSPAN3, anticorps tspan3, anticorps tspan3a, anticorps tspan3.S, anticorps Tspan3
- Sujet
- TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Poids moléculaire
- 25 kDa (MW of target protein)
-