CYP4X1 anticorps (Middle Region)

N° du produit ABIN635822

Détail du produit anti-CYP4X1 anticorps

Antigène: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP4X1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP4 X1 antibody was raised against the middle region of CYP4 1

Purification: Affinity purified

Immunogène: CYP4 X1 antibody was raised using the middle region of CYP4 1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP4X1 Blocking Peptide, catalog no. 33R-4850, is also available for use as a blocking control in assays to test for specificity of this CYP4X1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP4X1

Antigène: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Autre désignation: CYP4X1 (CYP4X1 Produits)

Synonymes: anticorps CYPIVX1, anticorps A230025G20, anticorps CYP_a, anticorps Cyp4a28-ps, anticorps cytochrome P450 family 4 subfamily X member 1, anticorps cytochrome P450, family 4, subfamily x, polypeptide 1, anticorps CYP4X1, anticorps Cyp4x1

Sujet: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha