AGPAT5 anticorps
-
- Antigène Voir toutes AGPAT5 Anticorps
- AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AGPAT5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE
- Top Product
- Discover our top product AGPAT5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AGPAT5 Blocking Peptide, catalog no. 33R-8041, is also available for use as a blocking control in assays to test for specificity of this AGPAT5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))
- Autre désignation
- AGPAT5 (AGPAT5 Produits)
- Synonymes
- anticorps AGPAT5, anticorps LPAAT-e, anticorps lpaate, anticorps 1agpat5, anticorps DKFZp469J1022, anticorps 1AGPAT5, anticorps LPAATE, anticorps RGD1306405, anticorps wu:fc35d05, anticorps zgc:154071, anticorps 1110013A05Rik, anticorps D8Ertd319e, anticorps 1-acylglycerol-3-phosphate O-acyltransferase 5, anticorps 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon), anticorps AGPAT5, anticorps agpat5, anticorps Agpat5
- Sujet
- Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
- Poids moléculaire
- 42 kDa (MW of target protein)
-