CYP1A1 anticorps (Middle Region)
-
- Antigène Voir toutes CYP1A1 Anticorps
- CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP1A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP1 A1 antibody was raised against the middle region of CYP1 1
- Purification
- Affinity purified
- Immunogène
- CYP1 A1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
- Top Product
- Discover our top product CYP1A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP1A1 Blocking Peptide, catalog no. 33R-7644, is also available for use as a blocking control in assays to test for specificity of this CYP1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
- Autre désignation
- CYP1A1 (CYP1A1 Produits)
- Synonymes
- anticorps AHH, anticorps AHRR, anticorps CP11, anticorps CYP1, anticorps P1-450, anticorps P450-C, anticorps P450DX, anticorps Cyp1a2, anticorps P450-1, anticorps cyp1a1, anticorps CYP1A1, anticorps CYPIA1, anticorps Cyp45c, anticorps Cypc45c, anticorps P-450MC, anticorps wu:fb63b04, anticorps zfCYP1A, anticorps zgc:109747, anticorps ahh, anticorps ahrr, anticorps cp11, anticorps cyp1, anticorps cyp1a, anticorps p1-450, anticorps p450-c, anticorps p450dx, anticorps cytochrome P450 family 1 subfamily A member 1, anticorps cytochrome P450 1A1, anticorps cytochrome P450, family 1, subfamily a, polypeptide 1, anticorps cytochrome P450, family 1, subfamily A, polypeptide 1, anticorps cytochrome P450 family 1 subfamily D polypeptide 1, anticorps cytochrome P4501A1, anticorps polycyclic hydrocarbon-inducible cytochrome P450c, anticorps cytochrome P450, family 1, subfamily A, anticorps cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1, anticorps cytochrome P450 family 1 subfamily A member 1 L homeolog, anticorps CYP1A1, anticorps CpipJ_CPIJ010542, anticorps Cyp1a1, anticorps cyp1d1, anticorps LOC100328613, anticorps cyp1a, anticorps LOC102129994, anticorps cyp1a1.L
- Sujet
- CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-