DLK1 anticorps

N° du produit ABIN635854

Cet anticorps Lapin Polyclonal détecte spécifiquement DLK1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour DLK1 anticorps (ABIN635854)

Antigène: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLK1 anticorps

Purification: Affinity purified

Immunogène: DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLK1 Blocking Peptide, (ABIN5613217), is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLK1

Antigène: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Autre désignation: DLK1

Sujet: DLK1 may have a role in neuroendocrine differentiation.

Poids moléculaire: 41 kDa (MW of target protein)