PERP anticorps (Middle Region)

N° du produit ABIN635864

Détail du produit anti-PERP anticorps

Antigène: PERP (TP53 Apoptosis Effector (PERP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PERP est non-conjugé

Application: Western Blotting (WB)

Specificité: PERP antibody was raised against the middle region of PERP

Purification: Affinity purified

Immunogène: PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PERP Blocking Peptide, catalog no. 33R-2984, is also available for use as a blocking control in assays to test for specificity of this PERP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PERP

Antigène: PERP (TP53 Apoptosis Effector (PERP))

Autre désignation: PERP (PERP Produits)

Synonymes: anticorps KCP1, anticorps KRTCAP1, anticorps PIGPC1, anticorps RP3-496H19.1, anticorps THW, anticorps dJ496H19.1, anticorps 1110017A08Rik, anticorps kcp1, anticorps krtcap1, anticorps pigpc1, anticorps thw, anticorps fk24g11, anticorps wu:fk24g11, anticorps PERP, anticorps PERP, TP53 apoptosis effector, anticorps PERP, TP53 apoptosis effector S homeolog, anticorps PERP, anticorps Perp, anticorps perp.S, anticorps perp

Sujet: PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity